| Edit |   |
| Antigenic Specificity | MUC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat, porcine, bovine, equine, guinea pig, goat, rabbit |
| Isotype | n/a |
| Format | DyLight 594 conjugate |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Optimal dilution of this antibody should be experimentally determined. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MUC1 Antibody [DyLight 594] from Novus Biologicals is a rabbit polyclonal antibody to MUC1. This antibody reacts with human, mouse, rat, porcine, bovine, equine, guinea pig, goat, rabbit. The MUC1 Antibody [DyLight 594] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal of MUC1 [NP_001037855]. Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
| Other Names | Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, CD227, CD227 antigen, DF3 antigen, EMA, episialin, H23 antigen, H23AG, KL-6, MAM6, MUC-1, MUC1/ZD, mucin 1, cell surface associated, mucin 1, transmembrane, mucin-1, Peanut-reactive urinary mucin, PEMMUC-1/SEC, PEMT, Polymorphic epithelial mucin, PUMMUC-1/X, tumor associated epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin |
| Gene, Accession # | MUC1, Gene ID: 4582 |
| Catalog # | NBP1-60046DL594 |
| Price | |
| Order / More Info | MUC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |