| Edit |   |
| Antigenic Specificity | CYP21A2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CYP21A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYP21A2. This antibody reacts with human. The CYP21A2 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CYP21A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LIGGTETTANTLSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEV |
| Other Names | 21-OHase, CA21HCYP21B, CAH1, CPS1, CYP21EC 1.14.99.10, Cytochrome P450 21, Cytochrome P450 XXI, cytochrome P450, family 21, subfamily A, polypeptide 2, cytochrome P450, subfamily XXIA (steroid 21-hydroxylase, congenital adrenalhyperplasia), polypeptide 2, Cytochrome P-450c21, Cytochrome P450-C21, Cytochrome P450-C21B, EC 1.14.99, MGC150536, MGC150537, P450c21B, steroid 21-hydroxylase, steroid 21-monooxygenase |
| Gene, Accession # | CYP21A2, Gene ID: 1589, Accession: P08686, SwissProt: P08686 |
| Catalog # | NBP2-38698 |
| Price | |
| Order / More Info | CYP21A2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |