| Edit |   |
| Antigenic Specificity | CYLD |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CYLD Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYLD. This antibody reacts with human. The CYLD Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CYLD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHINDIIPESVTQER |
| Other Names | CDMT, CYLD1MFT, CYLDI, cylindromatosis (turban tumor syndrome), Deubiquitinating enzyme CYLD, EAC, EC 3.1.2.15, EC 3.4.19.12, FLJ20180, FLJ31664, KIAA0849FLJ78684, MFT1, probable ubiquitin carboxyl-terminal hydrolase CYLD, SBS, TEM, ubiquitin carboxyl-terminal hydrolase CYLD, ubiquitin specific peptidase like 2, ubiquitin thioesterase CYLD, Ubiquitin thiolesterase CYLD, Ubiquitin-specific-processing protease CYLD, USPL2 |
| Gene, Accession # | CYLD, Gene ID: 1540, Accession: Q9NQC7, SwissProt: Q9NQC7 |
| Catalog # | NBP2-33589 |
| Price | |
| Order / More Info | CYLD Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |